PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma127g00090.1
Common NameZOSMA_127G00090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MIKC_MADS
Protein Properties Length: 252aa    MW: 28769.3 Da    PI: 8.3614
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma127g00090.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.26.7e-31959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++gkl+e++s
  Zosma127g00090.1  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLFEFCS 59
                      79***********************************************96 PP

2K-box99.35.4e-3383172897
             K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                       ++ +++++++++e+++Lk+++e+Lqr+qR+llGedL++Ls keL qLe+q+e sl++iRs K++l+ +q+++l++ke++lqe+n+aLr+k
  Zosma127g00090.1  83 QVPSRETQNSHHEYQRLKARVEMLQRSQRNLLGEDLSDLSAKELDQLENQIEMSLRSIRSVKTQLMADQLNDLKRKEEMLQETNHALRRK 172
                       478899**********************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.5E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.113161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.79E-33279IPR002100Transcription factor, MADS-box
CDDcd002651.42E-43276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-31323IPR002100Transcription factor, MADS-box
PfamPF003194.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-313859IPR002100Transcription factor, MADS-box
PfamPF014862.3E-2786172IPR002487Transcription factor, K-box
PROSITE profilePS5129715.49989180IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MGRGRVVLKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIVFSN RGKLFEFCSS  60
SSMPKTLERY QKCSYAPSET AAQVPSRETQ NSHHEYQRLK ARVEMLQRSQ RNLLGEDLSD  120
LSAKELDQLE NQIEMSLRSI RSVKTQLMAD QLNDLKRKEE MLQETNHALR RKEYCVSENI  180
CLQLAWENNR ETAGSEFQQF DPHTTQPEGF FQPLGCDPSL QIGYHQISSN NNTTGSSSQN  240
ISGYNNINAW G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_D4e-2584170898Developmental protein SEPALLATA 3
4ox0_C4e-2584170898Developmental protein SEPALLATA 3
4ox0_B4e-2584170898Developmental protein SEPALLATA 3
4ox0_A4e-2584170898Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008811037.11e-109PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform X4
SwissprotQ396858e-94CMB1_DIACA; MADS-box protein CMB1
TrEMBLA0A0K9PZY30.0A0A0K9PZY3_Z
STRINGGSMUA_Achr8P28100_0017e-99(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34833469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15800.19e-89MIKC_MADS family protein